DDB1/CRBN Complex, Flag&His Tag, Human
SKU: 45357149263

DDB1/CRBN Complex, Flag&His Tag, Human

Sale price$162.00 Regular price$180.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 6 - Jul 11

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

DDB1/CRBN Complex, Flag&His Tag, HumanProduct Specification Species Human Synonyms DDB1 CRBN Complex Accession Q16531Q96SW2 Amino Acid Sequence DDB1 Flag Tag, Human Met1 His1140

Product Specification


Species Human
Synonyms DDB1/CRBN Complex
Accession Q16531、Q96SW2
Amino Acid Sequence

DDB1 Flag Tag, Human
Met1-His1140
DYKDDDDKMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
CRBN His Tag, Human
Met1-Leu442
HHHHHHHHGGGSGGGSMAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQA
KVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL

Expression System Baculovirus-InsectCells
Molecular Weight

128&53kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tags & Cleavage sites Flag Tag; His Tag
Physical Appearance Liquid
Storage Buffer 20mM Tris,300mM NaCl,10%Glycerol,1mM DTT, pH7.5.
Stability & Storage

·12 months from date of receipt, -20 to -70 °C as supplied.
·1 month, 2 to 8 °C under sterile conditions after reconstitution.
·Please avoid repeated freeze-thaw cycles.

Reference

Fischer E.S.,et al. (2014) Nature 512: 49
He Y.J., et al. (2006) Genes Dev. 20: 2949
Ito T., et al. (2010) Science 327: 1345
Wang H., et al. (2006) Mol. Cell 22: 383

Background

Cereblon (CRBN) is the substrate recognition component of DCX (DDB1-CUL4-X-box) E3 Ubiquitin ligase complexes that mediate the ubiquitination of numerous target proteins including the transcriptional regulator MEIS2. CRBN plays an important role in limb outgrowth, and its function in this process is perturbed by the binding of thalidomide and related compounds. Binding of CRBN to Cullin-4 is mediated in part by DNA damage-binding protein 1 (DDB1), a component of multiple DCX class ligases. In addition to its role in limb development, DDB1 is also involved in various DNA damage response mechanisms. This product consists of an untagged complex of DDB1 and CRBN.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 45357149263

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 1161 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
STL Girl
West Palm Beach, US
★★★★★ 5
Where has this been all my life. Fits a lot. Doesn’t get gross.
Color: Black, Size: with Dishcloth Holder
I don’t know where this thing has been all my life. Over the years I’ve tried so many ways to keep all the dishwashing stuff organized and not dripping on the counter or getting lost in the sink. Every holder I had before would catch water and end up gross. This one actually works. It fits perfectly on the back ledge of my sink, and I love the little spout that angles into the sink. It’s just big enough to clear the edge but small enough that it’s not in the way. The rack for hanging our blue scrubby is my favorite part. There is never a great place for that thing. The rack does come unhooked easily, including if we bump it, but was easily fixed by taking some pliers and just tightening where it clamps on a bit. It holds more than I expected. The bottom is angled so water drains right out through the spout instead of pooling. It’s very nice quality - does not feel cheap. Honestly, I love it more than I thought I would.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 12, 2025
M
Verified Purchase
M. A. Mebane
Lowell, US
★★★★★ 5
Good Product
Color: Black, Size: with Dishcloth Holder
Great product. Serves its designed purpose.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
T
Verified Purchase
Terwya
Natrona Heights, US
★★★★★ 3
Its looks nice but its not as it seems in the photos
Color: Black, Size: with Dishcloth Holder
Its ok. Unless I am doing something wrong it is not adjustable unless they meant only the drain. The middle section couldn't be removed to make an area bigger or smaller it's permanent. So the middle section is a lot smaller than it seems. The taller section to place your cleaning tool can not be tall over wise it just hangs over and drips in the sink. The drain part is a nice idea but because it's straight and not curved a little down, the water stays in the drain and you have to tip it forward to get the water out. Looked nice in black.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 30, 2026
F
Verified Purchase
Frank 's wife
Birmingham, US
★★★★★ 5
Great organization
Color: Black, Size: with Dishcloth Holder
Cleans up the sink area and the built in drain works good
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
P
Verified Purchase
Pam Crosby
Carnegie, US
★★★★★ 5
Just what I needed!
Color: Black, Size: with Dishcloth Holder
Holds all my sink brushes and scrubbies. I have black accents in my kitchen and goes nicely. I especially love the dish rag bar.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026

recommand products